Chlorotoxin

Chlorotoxin
Names
IUPAC name
L-methionyl-L-cysteinyl-L-methionyl-L-prolyl-L-cysteinyl-L-phenylalanyl-L-threonyl-L-threonyl-L-.alpha.-aspartyl-L-histidyl-L-glutaminyl-L-methionyl-L-alanyl-L-arginyl-L-lysyl-L-cysteinyl-L-α-aspartyl-L-α-aspartyl-L-cysteinyl-L-cysteinylglycylglycyl-L-lysylglycyl-L-arginylglycyl-L-lysyl-L-cysteinyl-L-tyrosylglycyl-L-prolyl-L-glutaminyl-L-cysteinyl-L-leucyl-L-cysteinyl-L-argininamide, cyclic (219),(528),(1633),(2035)-tetrakis(disulfide)
Other names
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR
Identifiers
CAS Number
3D model (JSmol)
ChemSpider
PubChem CID
UNII
InChI
  • InChI=1S/C158H249N53O47S11/c1-77(2)55-96-138(241)205-105(144(247)186-86(125(165)228)28-18-47-173-156(166)167)70-264-262-68-103-131(234)177-63-115(217)176-64-116(218)183-87(25-12-15-44-159)128(231)178-65-117(219)184-88(29-19-48-174-157(168)169)129(232)179-66-118(220)185-89(26-13-16-45-160)133(236)202-107-72-267-269-75-110-149(252)195-98(56-81-23-10-9-11-24-81)143(246)208-124(80(5)213)154(257)209-123(79(4)212)153(256)199-102(61-122(226)227)141(244)196-99(58-83-62-172-76-181-83)139(242)189-92(37-39-113(163)215)136(239)190-94(42-53-260-7)132(235)182-78(3)126(229)187-91(30-20-49-175-158(170)171)134(237)188-90(27-14-17-46-161)135(238)203-108(73-266-265-71-106(146(249)193-96)204-137(240)93(38-40-114(164)216)191-151(254)111-31-21-50-210(111)119(221)67-180-130(233)97(194-147(107)250)57-82-33-35-84(214)36-34-82)148(251)198-100(59-120(222)223)140(243)197-101(60-121(224)225)142(245)206-109(150(253)201-103)74-268-263-69-104(200-127(230)85(162)41-52-259-6)145(248)192-95(43-54-261-8)155(258)211-51-22-32-112(211)152(255)207-110/h9-11,23-24,33-36,62,76-80,85-112,123-124,212-214H,12-22,25-32,37-61,63-75,159-162H2,1-8H3,(H2,163,215)(H2,164,216)(H2,165,228)(H,172,181)(H,176,217)(H,177,234)(H,178,231)(H,179,232)(H,180,233)(H,182,235)(H,183,218)(H,184,219)(H,185,220)(H,186,247)(H,187,229)(H,188,237)(H,189,242)(H,190,239)(H,191,254)(H,192,248)(H,193,249)(H,194,250)(H,195,252)(H,196,244)(H,197,243)(H,198,251)(H,199,256)(H,200,230)(H,201,253)(H,202,236)(H,203,238)(H,204,240)(H,205,241)(H,206,245)(H,207,255)(H,208,246)(H,209,257)(H,222,223)(H,224,225)(H,226,227)(H4,166,167,173)(H4,168,169,174)(H4,170,171,175)/t78-,79+,80+,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,123-,124-/m0/s1
    Key: QPAKKWCQMHUHNI-GQIQPHNSSA-N
SMILES
  • C[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@H]4C(=O)NCC(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1)CCSC)CCC(=O)N)CC5=CNC=N5)CC(=O)O)[C@@H](C)O)[C@@H](C)O)CC6=CC=CC=C6)NC(=O)[C@@H]7CCCN7C(=O)[C@@H](NC(=O)[C@H](CSSC[C@@H](C(=O)N4)NC(=O)[C@@H](NC(=O)[C@@H](NC2=O)CC(=O)O)CC(=O)O)NC(=O)[C@H](CCSC)N)CCSC)C(=O)N[C@H](C(=O)NCC(=O)N8CCC[C@H]8C(=O)N[C@H](C(=O)N3)CCC(=O)N)CC9=CC=C(C=C9)O)CCCCN)CCCNC(=N)N)CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N)CC(C)C)CCCCN)CCCNC(=N)N
Properties
Chemical formula
C158H249N53O47S11
Molar mass 3995.71 g·mol−1
Except where otherwise noted, data are given for materials in their standard state (at 25 °C [77 °F], 100 kPa).
☒N verify (what is checkY☒N ?)
Infobox references

Chlorotoxin is a 36-amino acid peptide found in the venom of the deathstalker scorpion (Leiurus quinquestriatus) which blocks small-conductance chloride channels.[2] The fact that chlorotoxin binds preferentially to glioma cells has allowed the development of methods for the treatment and diagnosis of several types of cancer.[3]

Sources

Chlorotoxin can be purified from crude leiurus, which belongs to the scorpion toxin protein superfamily.[4]

Chemistry

Chlorotoxin is a small toxin and at pH 7 is highly positively charged. It is a peptide consisting of 36 amino acids, with 8 cysteines forming 4 disulfide bonds.[5] Chlorotoxin has a considerable sequence homology to the class of small insectotoxins.[4][6]

Target

Chlorotoxin is the first reported high-affinity peptide ligand for Cl− channels and it blocks small conductance chloride channels. Each chloride channel can be closed by only one ligand molecule.[2][4]

Using a recombinant chlorotoxin it was demonstrated that chlorotoxin specifically and selectively interacts with MMP-2 isoforms which are specifically upregulated in gliomas and related cancers, but are not normally expressed in brain.[3]

Toxicity

Chlorotoxin immobilizes the envenomated prey. Duration of paralysis depends on the amount of chlorotoxin injected. In crayfish, chlorotoxin at 1.23-2.23 µg/g body wt produced a loss of motor control beginning about 20 seconds after injection which progressed to a rigid paralysis of the walking and pincer legs that was complete about forty seconds later. Within ±90 s of injection the tail musculature was immobilized. No recovery was noted for 6 hours, at which time the crayfish were destroyed. At 0.5 µg/g, chlorotoxin induced the same progressive paralysis with a slower onset. Recovery of crayfish was noted after 2 hours. The injection on insects produced similar results to those observed in crayfish.[4]

Possible therapeutic use

The fact that chlorotoxin binds preferentially to glioma cells compared with non-neoplastic cells or normal brain has allowed the development of new methods for the treatment and diagnosis of several types of cancer.[7]

Chlorotoxin has the ability to interact with chloride channels in membrane protein in glioma cells, so this prevents transmembrane chloride fluxes but this interaction does not happen for the neurons and normal glial cells. This suggests a potential treatment for cancer.[8]

A report showed the anti-invasive effect of chlorotoxin on glioma cells mediated by its interaction with MMP-2, which allows the penetration of normal and tumor cells through tissue barriers. Chlorotoxin exerts a dual effect on MMP-2: it inhibits the enzymatic activity of MMP-2 and causes a reduction in the surface expression of MMP-2. This result implies the use of chlorotoxin as a highly effective drug of therapeutic potential for diseases that involve the activity of MMP-2.[3]

TM-601 which is the synthetic version of chlorotoxin is under phase II clinical trial. Iodine-131-TM-601 is used to treat malignant glioma. TM-601 is also a candidate for targeting gliomas because it crosses blood-brain and tissue barriers and binds to malignant brain tumor cells without affecting healthy tissue.[9]

Phase II trials are being conducted on the use of chlorotoxin for imaging and radio therapy in glioma.[10]

Chlorotoxin:Cy5.5 (CTX:Cy5.5), which is a bioconjugate of chlorotoxin and a fluorescent dye named Cy5.5, was used by researchers at Seattle Children's Hospital Research Institute and Fred Hutchinson Cancer Research Center to distinguish cancer cells from the surrounding normal cells.[11] This could enable surgeons to remove cancerous cells without injuring the surrounding healthy tissue. CTX:Cy5.5 is a fluorescent molecule emitting photons in the near infrared spectrum and hence can be visualized in the operating room with the aid of infrared glasses. Studies in mouse models have shown that CTX:Cy5.5 can identify tumors with as few as 2000 cancer cells, making it 500 times more sensitive than MRI. Treated animals exhibited no neurologic or behavioral deficits, and postmortem studies revealed no evidence of neuropathy.[12] In 2015, clinical trials were beginning for this "Tumor Paint."[13]

In the episode "Both Sides Now" of medical drama House, House suggests using a scorpion derived toxin to paint the pancreas and view it under infrared light to look for tumors too small to detect by MRI.[14]

References

  1. ↑ "Chlorotoxin from Leiurus quinquestriatus (north Africa)". Sigmaaldrich.com. Retrieved November 30, 2021.
  2. 1 2 DeBin JA, Strichartz GR (1991). "Chloride channel inhibition by the venom of the scorpion Leiurus quinquestriatus". Toxicon. 29 (11): 1403–8. doi:10.1016/0041-0101(91)90128-E. PMID 1726031.
  3. 1 2 3 Deshane J, Garner CC, Sontheimer H (February 2003). "Chlorotoxin inhibits glioma cell invasion via matrix metalloproteinase-2". J. Biol. Chem. 278 (6): 4135–44. doi:10.1074/jbc.M205662200. PMID 12454020.
  4. 1 2 3 4 DeBin JA, Maggio JE, Strichartz GR (February 1993). "Purification and characterization of chlorotoxin, a chloride channel ligand from the venom of the scorpion". Am. J. Physiol. 264 (2 Pt 1): C361–9. doi:10.1152/ajpcell.1993.264.2.C361. PMID 8383429.
  5. ↑ Lippens G, Najib J, Wodak SJ, Tartar A (January 1995). "NMR sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels". Biochemistry. 34 (1): 13–21. doi:10.1021/bi00001a003. PMID 7819188.
  6. ↑ Wudayagiri R, Inceoglu B, Herrmann R, Derbel M, Choudary PV, Hammock BD (2001). "Isolation and characterization of a novel lepidopteran-selective toxin from the venom of South Indian red scorpion, Mesobuthus tamulus". BMC Biochem. 2: 16. doi:10.1186/1471-2091-2-16. PMC 64496. PMID 11782289.
  7. ↑ Soroceanu L, Gillespie Y, Khazaeli MB, Sontheimer H (November 1998). "Use of chlorotoxin for targeting of primary brain tumors". Cancer Res. 58 (21): 4871–9. PMID 9809993.
  8. ↑ Lyons SA, O'Neal J, Sontheimer H (August 2002). "Chlorotoxin, a scorpion-derived peptide, specifically binds to gliomas and tumors of neuroectodermal origin". Glia. 39 (2): 162–73. doi:10.1002/glia.10083. PMID 12112367. S2CID 8513870.
  9. ↑ Mamelak AN, Rosenfeld S, Bucholz R, et al. (August 2006). "Phase I single-dose study of intracavitary-administered iodine-131-TM-601 in adults with recurrent high-grade glioma". J. Clin. Oncol. 24 (22): 3644–50. doi:10.1200/JCO.2005.05.4569. PMID 16877732.
  10. ↑ Mark R. Stroud; Stacey J. Hansen; James M. Olson (December 2011). "In Vivo Bio Imaging Using Chlorotoxin Based Conjugates". Current Pharmaceutical Design. 17 (38): 4362–71. doi:10.2174/138161211798999375. PMC 3272502. PMID 22204434.
  11. ↑ Veiseh M, Gabikian P, Bahrami SB, et al. (July 2007). "Tumor paint: a chlorotoxin:Cy5.5 bioconjugate for intraoperative visualization of cancer foci". Cancer Res. 67 (14): 6882–8. doi:10.1158/0008-5472.CAN-06-3948. PMID 17638899.
  12. ↑ "Tumor Painting Revolutionizes Fight Against Cancer". 15 July 2007. Archived from the original on 4 June 2016. Retrieved 11 September 2015.
  13. ↑ Fidel, J.; Kennedy, K. C.; Dernell, W. S.; Hansen, S.; Wiss, V.; Stroud, M. R.; Molho, J. I.; Knoblaugh, S. E.; Meganck, J.; Olson, J. M.; Rice, B.; Parrish-Novak, J. (2015). "Preclinical validation of the utility of BLZ-100 in providing fluorescence contrast for imaging canine spontaneous solid tumors". Cancer Research. 75 (20): 4283–4291. doi:10.1158/0008-5472.CAN-15-0471. PMC 4610180. PMID 26471914.
  14. ↑ "Both Sides Now synopsis". IMDb.com. Retrieved 30 November 2015.
This article is issued from Wmcloud. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.